PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00009825-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family WOX
Protein Properties Length: 226aa    MW: 25844.2 Da    PI: 8.964
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00009825-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.4e-2187146357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  WALNUT_00009825-RA  87 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 146
                         7*****************99**************************************97 PP

2Wus_type_Homeobox118.53e-3887148465
   Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         tRW+Pt+eQi iLe+lyk G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  WALNUT_00009825-RA  87 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 148
                         8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.20382147IPR001356Homeobox domain
SuperFamilySSF466897.7E-1383152IPR009057Homeodomain-like
SMARTSM003895.8E-884151IPR001356Homeobox domain
CDDcd000867.43E-687148No hitNo description
PfamPF000462.7E-1987146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-888146IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGSMKVHQFA RGSFWDHHEP SLTLGCMKRL RPLAPKQANS DNTPTSTLPA AFDLKSFIKP  60
ESGPRKLGSS DDKRDSPAQV ETHPGGTRWN PTQEQIGILE MLYKGGMRTP NAQQIEQITA  120
QLGKYGKIEG KNVFYWFQNH KARERQKQKR NSLGLGHCPR TPAPITTMIT LETRGSELER  180
DQEDSPYKRK CRSWGFESLE EESCKIYCKE EEDRTLELFP LHPEGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884316.11e-125PREDICTED: WUSCHEL-related homeobox 4
SwissprotQ6X7J98e-82WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A061FCE51e-122A0A061FCE5_THECC; WUSCHEL related homeobox 4
STRINGVIT_18s0001g10160.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.15e-83WUSCHEL related homeobox 4